Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-44 (srd-44)

This Recombinant Serpentine receptor class delta-44 (srd-44) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-44, Protein srd-44

UniProt

O17823

Expression Region

1-317

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRKILSVLNPTVFVLSLCFQIILIYTIIRHSPKNLSTLKAILLTNCCFQLLQSSMVFFT QIQLVNHLVPIELWSYGPCRHFEAFMCYSMFHILQTSSLVSGLTVFLTTFMKYQAARHVR PSKKKNCFVILFISSIVLISAGCGILLVIIQALPLEIREKYYRINLELDEYSVIGIVDYS VLPSRVNGIIINGLVVIVPITCLLLRRKILKLLTASSDALYFQNRVFLQGLTLQIFGHTL VYVPIFICSTISLITKTEYTFAQFFIFVLPHLTTVIDPLLTMYFVTPYRKRLMVWLRLKN DKVHSVSPSTFAVSANH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Orthovanadate
TRC-S655003-100G 100 g

Sodium Orthovanadate

Sign In for Pricing
View Details
HAGH Antibody (Biotin)
KB-8232-01 50 μL

HAGH Antibody (Biotin)

Sign In for Pricing
View Details
HAGH Antibody (Biotin)
KB-8232-02 100 µL

HAGH Antibody (Biotin)

Sign In for Pricing
View Details
HAGH Antibody (Biotin)
KB-8232-03 1 mL

HAGH Antibody (Biotin)

Sign In for Pricing
View Details
EMSY Rabbit Polyclonal Antibody
TA384171 100 µL

EMSY Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNC1 Human Gene Knockout Kit (CRISPR)
KN415716 1 Kit

KCNC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details