Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

This Recombinant Kluyveromyces lactis Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Mitochondrial thiamine pyrophosphate carrier 1

UniProt

Q6CQR3

Expression Region

1-317

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTGIRKDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIA STVRTIMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTV GALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTV TLSTAIMFLTYETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMN SKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVY ERTMDLFDHGQRWGRSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-500 1x 500 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details