Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 121 (Tmem121)

This Recombinant Mouse Transmembrane protein 121 (Tmem121) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Transmembrane protein 121, Protein hole

UniProt

Q80XA0

Expression Region

1-318

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVA VWVGAEVRTAKRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVC VPGLFLLLVALDRMEYVRTFRKREDLRGRLFWVALDLLDLLDMQANLWEPPRTGLPLWAE GLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQKMMLYPVLSLATVNVVAVLARAANMALF RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALALELQPPPSQRNSVPPPPPLH GPPVRPHGPSPTRDALDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elovl4 (NM_148941) Mouse Tagged Lenti ORF Clone
MR225811L4 10 µg

Elovl4 (NM_148941) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-PTPN13 Antibody Picoband® Fluoro647 Conjugated
A02481-1-Fluoro647 100 µg/Vial

Anti-PTPN13 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit
MBS9349211-01 48 Well

Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit

Sign In for Pricing
View Details
Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit
MBS9349211-02 96 Well

Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit

Sign In for Pricing
View Details
Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit
MBS9349211-03 5x 96 Well

Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit

Sign In for Pricing
View Details
Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit
MBS9349211-04 10x 96 Well

Mouse Cochlin Antibody IgG (COCH-IgG) ELISA Kit

Sign In for Pricing
View Details