Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 121 (Tmem121)

This Recombinant Mouse Transmembrane protein 121 (Tmem121) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Transmembrane protein 121, Protein hole

UniProt

Q80XA0

Expression Region

1-318

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVA VWVGAEVRTAKRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVC VPGLFLLLVALDRMEYVRTFRKREDLRGRLFWVALDLLDLLDMQANLWEPPRTGLPLWAE GLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQKMMLYPVLSLATVNVVAVLARAANMALF RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALALELQPPPSQRNSVPPPPPLH GPPVRPHGPSPTRDALDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly(ethylene Glycol) (~2000)
TRC-P688350-500MG 500 mg

Poly(ethylene Glycol) (~2000)

Sign In for Pricing
View Details
S100A1 Calcium Binding Protein (S100A1) Antibody
abx174436-01 100 µL

S100A1 Calcium Binding Protein (S100A1) Antibody

Sign In for Pricing
View Details
S100A1 Calcium Binding Protein (S100A1) Antibody
abx174436-02 200 µL

S100A1 Calcium Binding Protein (S100A1) Antibody

Sign In for Pricing
View Details
S100A1 Calcium Binding Protein (S100A1) Antibody
abx174436-03 1 mL

S100A1 Calcium Binding Protein (S100A1) Antibody

Sign In for Pricing
View Details
Slc9a2 Rat shRNA Plasmid (Locus ID 24783)
TR708200 1 Kit

Slc9a2 Rat shRNA Plasmid (Locus ID 24783)

Sign In for Pricing
View Details
MR1 Polyclonal Antibody
MBS2575518-01 0.06 mL

MR1 Polyclonal Antibody

Sign In for Pricing
View Details