Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus oryzae Mitochondrial thiamine pyrophosphate carrier 1 (tpc1)

This Recombinant Aspergillus oryzae Mitochondrial thiamine pyrophosphate carrier 1 (tpc1) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Mitochondrial thiamine pyrophosphate carrier 1

UniProt

Q2UCW8

Expression Region

1-318

Origin

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAGGEHLKDEGTRRQVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPTSHQNIKG PVYKGTLPTIRSIVREEGITGLWKGNIPAELMYVCYGAIQFAAYRTTTQALSQLDPYRLP PPAESFVAGATAGGLATASTYPLDLLRTRFAAQGTERVYTSLYASVRDIAQNEGPKGFFR GCSAAVGQIVPYMGLFFATYESLRPVMSGLHDLPFGSGDAAAGVVASVLAKTGVFPLDLV RKRLQVQGPTRSKYVHRNIPEYQGVYNTMAMIVRTQGMRGLYRGLTVSLFKAAPASAVTM WTYEKSLHYLRELEVASE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-100 1x 100 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-500 1x 500 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF640R conjugate, 0.1mg/mL
BNC402340-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF594 conjugate, 0.1mg/mL
BNC940198-500 1x 500 µL

Cytokeratin 18 (DA7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD99 (MIC2/877), CF660R conjugate, 0.1mg/mL
BNC610877-500 1x 500 µL

CD99 (MIC2/877), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details