Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable polyprenol reductase (SRD5A3)

This Recombinant Human Probable polyprenol reductase (SRD5A3) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Probable polyprenol reductase, EC= 1.3.1.-, 3-oxo-5-alpha-steroid 4-dehydrogenase 3, EC= 1.3.99.5, Steroid 5-alpha-reductase 2-like, Steroid 5-alpha-reductase 3, S5AR 3

UniProt

Q9H8P0

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK SKFVSYPKHRKAFLPFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody
PA86473HU-01 50 µg

Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody
PA86473HU-02 100 µg

Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody
PA86473HU-03 500 µg

Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody
PA86473HU-04 1 mg

Rabbit Anti-Human Olfactory receptor 4K14 Polyclonal Antibody

Sign In for Pricing
View Details
MT-CO3 Antibody (N-term) Blocking Peptide
MBS9224028-01 0.5 mg

MT-CO3 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
MT-CO3 Antibody (N-term) Blocking Peptide
MBS9224028-02 5x 0.5 mg

MT-CO3 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details