Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ailuropoda melanoleuca Probable polyprenol reductase (SRD5A3)

This Recombinant Ailuropoda melanoleuca Probable polyprenol reductase (SRD5A3) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Probable polyprenol reductase, EC= 1.3.1.-, 3-oxo-5-alpha-steroid 4-dehydrogenase 3, EC= 1.3.99.5, Steroid 5-alpha-reductase 3, S5AR 3, SR type 3

UniProt

D2HBV9

Expression Region

1-318

Origin

Ailuropoda melanoleuca (Giant panda)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWAAAQLWALNPLRALWLTLAAAFLLTLLLQLVPPGLLPGCALFQDLIRYGKTKREGQ SRPAVCRVFDVPKRYFSHFYIISALWNGFLLWHLTQSVFLGVPFPNWLHGLLRILGASQF QGGELALSAFLVLVFLWLHSLRRLFECFYVSVFSNTVIHIVQYCFGLVYYVLTGLTVLSQ VPMDGRNAYVIGKNLLMQARWFHILGMLMFIWSSVHQYKCHVILGNLRKNKAGVVIHCNH RIPFGDWFEYVSSPNYLAELMIYISMAVTFGFHNLTWWLVVTYVFFSQALSAFLSHKFYK SKFVSYPKHRKAFLPFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF640R conjugate, 0.1mg/mL
BNC402029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF647 conjugate, 0.1mg/mL
BNC471991-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details