Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protein lplB (lplB)

This Recombinant Bacillus subtilis Protein lplB (lplB) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Protein lplB

UniProt

P39128

Expression Region

1-318

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVPKKRDAPVLTAGKGISWMAALKRDKWLYLLLIPGLLYFLIFKYLPMWGVLIAFKDY SPYLGFWKSEWVGFDYFKDFFMNPDFFRLLRNTLMLASLDLLFAFPAPLILALLLNEVRK AVYKRCIQTFIYVPHFVSWTIVVSITFVFFTVDTGVINKLIMSLTGEQISFLSDADWFRP MIVMQSIWKETGWGTILFLAALATVDQEQYEAAIMDGAGRFRRMWHITLPAIRSTIIVLL ILRIGSFLNLGFEQVYLMTNSLNRSVADIFDTYVYMMGITQGAYSYSTAVGLFKSVVGII LIFGANYIAKKFDQEGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pinacidil Monohydrate
SIH-563-50MG 50 mg

Pinacidil Monohydrate

Sign In for Pricing
View Details
Recombinant LBR Antibody
RC-4788-01 50 μL

Recombinant LBR Antibody

Sign In for Pricing
View Details
Recombinant LBR Antibody
RC-4788-02 100 µL

Recombinant LBR Antibody

Sign In for Pricing
View Details
Recombinant LBR Antibody
RC-4788-03 1 mL

Recombinant LBR Antibody

Sign In for Pricing
View Details
HMG1 (HMGB1) Human Gene Knockout Kit (CRISPR)
KN205918LP 1 Kit

HMG1 (HMGB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMURF1 (N-term) Rabbit Polyclonal Antibody
AP11952PU-N 400 µL

SMURF1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details