Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppB (oppB)

This Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppB (oppB) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Oligopeptide transport system permease protein oppB

UniProt

P0A4N7

Expression Region

1-319

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKVIIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDP WWEQYLRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVA ARNEGKWQDQLWLTYNSITFGIPPYVFYLLIIFIFGYSLNWFPTGGTVSPDAMGIIPVFF SKIYHMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNA SLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITALILLNGFLGLL GALLSDIIMAMVDPRIRIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL
BNC683101-500 1x 500 µL

PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMAD1 Antibody
KC-3267-01 50 μL

SMAD1 Antibody

Sign In for Pricing
View Details
SMAD1 Antibody
KC-3267-02 100 µL

SMAD1 Antibody

Sign In for Pricing
View Details
SMAD1 Antibody
KC-3267-03 1 mL

SMAD1 Antibody

Sign In for Pricing
View Details
MAPKAP Kinase 2 (MAPKAPK2) Rabbit Polyclonal Antibody
AP02791PU-N 100 µL

MAPKAP Kinase 2 (MAPKAPK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vertical Autoclave BAVT-104
BAVT-104 1 Unit

Vertical Autoclave BAVT-104

Sign In for Pricing
View Details