Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Putative peptide permease protein BMEII0860 (BMEII0860)

This Recombinant Brucella melitensis biotype 1 Putative peptide permease protein BMEII0860 (BMEII0860) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Putative peptide permease protein BMEII0860

UniProt

Q8YBN9

Expression Region

1-319

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRYCLHRLLIGLGMLLALTILIFVLLQLTPGDPIDAYINPNVAMTQAEMDALRAQLGLD RPLPVQYLAWLGQAVQGNLGHSLQRFNETVSGLIASRIGPTLLLMAAGLAIAIVIGVTTG IISAVRRNSFPDYSFSVLALLGISSPAFLTALLGLYVFSVRLKWAPSGGMLTPATDFSIP DLLRHLALPALVLSIGHAALIMRYMRSSMLETLNQDYVRTARAKGVREFWVVVKHTLRNA MLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINAVETRDYPVIMGATLVIGACVII VNILTDLAYAVIDPRIKVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFF4 (AF5q31, AF5Q31, MCEF, AF4/FMR2 Family Member 4, ALL1-fused Gene from Chromosome 5q31 Protein, Major CDK9 Elongation Factor-associated Protein) APC
MBS6135211-01 0.1 mL

AFF4 (AF5q31, AF5Q31, MCEF, AF4/FMR2 Family Member 4, ALL1-fused Gene from Chromosome 5q31 Protein, Major CDK9 Elongation Factor-associated Protein) APC

Sign In for Pricing
View Details
AFF4 (AF5q31, AF5Q31, MCEF, AF4/FMR2 Family Member 4, ALL1-fused Gene from Chromosome 5q31 Protein, Major CDK9 Elongation Factor-associated Protein) APC
MBS6135211-02 5x 0.1 mL

AFF4 (AF5q31, AF5Q31, MCEF, AF4/FMR2 Family Member 4, ALL1-fused Gene from Chromosome 5q31 Protein, Major CDK9 Elongation Factor-associated Protein) APC

Sign In for Pricing
View Details
Lentiviral mouse Tmem18 shRNA (UAS) - Lentiviral mouse Tmem18 shRNA (UAS, RFP) (100)
GTR15193056 1 Vial

Lentiviral mouse Tmem18 shRNA (UAS) - Lentiviral mouse Tmem18 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Apcs shRNA (UAS) - Lentiviral mouse Apcs shRNA (UAS, iRFP) (25)
GTR15176474 1 Vial

Lentiviral mouse Apcs shRNA (UAS) - Lentiviral mouse Apcs shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Dermokine (DMKN) (NM_001190347) Human Over-expression Lysate
LY434240 100 µg

Dermokine (DMKN) (NM_001190347) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) MIAA Polyclonal Antibody
MBS7142472 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) MIAA Polyclonal Antibody

Sign In for Pricing
View Details