Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Putative peptide permease protein BMEII0860 (BMEII0860)

This Recombinant Brucella melitensis biotype 1 Putative peptide permease protein BMEII0860 (BMEII0860) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Putative peptide permease protein BMEII0860

UniProt

Q8YBN9

Expression Region

1-319

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRYCLHRLLIGLGMLLALTILIFVLLQLTPGDPIDAYINPNVAMTQAEMDALRAQLGLD RPLPVQYLAWLGQAVQGNLGHSLQRFNETVSGLIASRIGPTLLLMAAGLAIAIVIGVTTG IISAVRRNSFPDYSFSVLALLGISSPAFLTALLGLYVFSVRLKWAPSGGMLTPATDFSIP DLLRHLALPALVLSIGHAALIMRYMRSSMLETLNQDYVRTARAKGVREFWVVVKHTLRNA MLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINAVETRDYPVIMGATLVIGACVII VNILTDLAYAVIDPRIKVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human MAGEB6 Over-expressing Stable Cell Line
ABC-X1798 1 Vial

Xpress™ Human MAGEB6 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
1- ({1-[ (tert-Butoxy) carbonyl]azetidin-3-yl}methyl) -1H-1,2,3-triazole-4-carboxylic acid
QID96771-01 100 mg

1- ({1-[ (tert-Butoxy) carbonyl]azetidin-3-yl}methyl) -1H-1,2,3-triazole-4-carboxylic acid

Sign In for Pricing
View Details
1- ({1-[ (tert-Butoxy) carbonyl]azetidin-3-yl}methyl) -1H-1,2,3-triazole-4-carboxylic acid
QID96771-02 1 g

1- ({1-[ (tert-Butoxy) carbonyl]azetidin-3-yl}methyl) -1H-1,2,3-triazole-4-carboxylic acid

Sign In for Pricing
View Details
LETMD1 (NM_015416) Human Tagged Lenti ORF Clone
RC209445L3 10 µg

LETMD1 (NM_015416) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-MARCKS (Ab-158)
orb1139636 100 µg

Anti-MARCKS (Ab-158)

Sign In for Pricing
View Details
P38 Polyclonal Antibody
41306-01 50 µL

P38 Polyclonal Antibody

Sign In for Pricing
View Details