Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Dipeptide transport system permease protein dppC (dppC)

This Recombinant Bacillus subtilis Dipeptide transport system permease protein dppC (dppC) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppC

UniProt

P26904

Expression Region

1-320

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLPVQTDERQPEQHNQVPDEWFVLNQEKNREADSVKRPSLSYTQDAWRRLKKNKLAMAG LFILLFLFVMAVIGPFLSPHSVVRQSLTEQNLPPSADHWFGTDELGRDVFTRTWYGARIS LFVGVMAALIDFLIGVIYGGVAGYKGGRIDSIMMRIIEVLYGLPYLLVVILLMVLMGPGL GTIIVALTVTGWVGMARIVRGQVLQIKNYEYVLASKTFGAKTFRIIRKNLLPNTMGAIIV QMTLTVPAAIFAESFLSFLGLGIQAPFASWGVMANDGLPTILSGHWWRLFFPAFFISLTM YAFNVLGDGLQDALDPKLRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TIMP1 Protein (His Tag)
PDEM100223-01 20 µg

Recombinant Mouse TIMP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TIMP1 Protein (His Tag)
PDEM100223-02 100 µg

Recombinant Mouse TIMP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TIMP1 Protein (His Tag)
PDEM100223-03 500 µg

Recombinant Mouse TIMP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TIMP1 Protein (His Tag)
PDEM100223-04 1 mg

Recombinant Mouse TIMP1 Protein (His Tag)

Sign In for Pricing
View Details
PABPC5 Antibody
KC-42071-01 50 μL

PABPC5 Antibody

Sign In for Pricing
View Details
PABPC5 Antibody
KC-42071-02 100 µL

PABPC5 Antibody

Sign In for Pricing
View Details