Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative fatty acid elongation protein 3 (elo-3)

This Recombinant Putative fatty acid elongation protein 3 (elo-3) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Putative fatty acid elongation protein 3, EC= 2.3.1.n8, 3-keto acyl-CoA synthase elo-3

UniProt

P49191

Expression Region

1-320

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKYDYNPKYGLENYSIFLPFETSFDAFRSTTWMQNHWYQSITASVVYVAVIFTGKKIME KYKPFQLDTPLFVWNSFLAIFSILGFLRMTPEFVWSWSAEGNSFKYSICHSSYAQGVTGF WTEQFAMSKLFELIDTIFIVLRKRPLIFLHWYHHVTVMIYTWHAYKDHTASGRWFIWMNY GVHALMYSYYALRSLKFRLPKQMAMVVTTLQLAQMVMGVIIGVTVYRIKSSGEYCQQTWD NLGLCFGVYFTYFLLFANFFYHAYVKKNNRYTEVKKDKKEKEEPVDFEILEPKEDINANI AEPSITTRSAAARRKVQKAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-100 1x 100 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-100 1x 100 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-500 1x 500 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details