Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Phosphate transport system permease protein pstC (pstC)

This Recombinant Pasteurella multocida Phosphate transport system permease protein pstC (pstC) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC

UniProt

Q9CNJ5

Expression Region

1-320

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRRKTQAETNRLNHHIIELLFRQTTRFFAIFVFLLLAAVMTSLVFGSWDSFSTFGFSFL WHNDWNPVQESYGAIIPIVGTLITSFLALIIAVPISFGIAIFLTELAPEWLRRPVGTAIE MLAAIPSIIYGMWGLFIFVPLFQEHIQPSLIEWFGDLPVFSYLFSGAPFGIGLFTAGLVL AIMIIPFIAAVMRDVFTIVPAILKESAYGLGSTTWEVMWKVVLPYTKTGVVGGIMLGLGR ALGETMAVTFVIGNAFHLPESLFSPSTSIASAIANEFNEASGLQKSALMELGLILFLITT VVLSISRLLIMRIEKKEGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit
RDR-COL1a2-Mu-01 96 Tests

Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details
Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit
RDR-COL1a2-Mu-02 48 Tests

Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details
D-Lyxose-13C5
TRC-L501007-5MG 5 mg

D-Lyxose-13C5

Sign In for Pricing
View Details
TDP43 (TARDBP) (NM_007375) Human Over-expression Lysate
LC402137 20 µg

TDP43 (TARDBP) (NM_007375) Human Over-expression Lysate

Sign In for Pricing
View Details
Fatty Acid Synthase (FASN) Rabbit Polyclonal Antibody
TA371655 100 µL

Fatty Acid Synthase (FASN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565453 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details