Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Phosphate transport system permease protein pstC (pstC)

This Recombinant Pasteurella multocida Phosphate transport system permease protein pstC (pstC) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC

UniProt

Q9CNJ5

Expression Region

1-320

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRRKTQAETNRLNHHIIELLFRQTTRFFAIFVFLLLAAVMTSLVFGSWDSFSTFGFSFL WHNDWNPVQESYGAIIPIVGTLITSFLALIIAVPISFGIAIFLTELAPEWLRRPVGTAIE MLAAIPSIIYGMWGLFIFVPLFQEHIQPSLIEWFGDLPVFSYLFSGAPFGIGLFTAGLVL AIMIIPFIAAVMRDVFTIVPAILKESAYGLGSTTWEVMWKVVLPYTKTGVVGGIMLGLGR ALGETMAVTFVIGNAFHLPESLFSPSTSIASAIANEFNEASGLQKSALMELGLILFLITT VVLSISRLLIMRIEKKEGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMyc-PCR Mycoplasma Test Kit
40601ES10 10 Assays

GMyc-PCR Mycoplasma Test Kit

Sign In for Pricing
View Details
Benzyl Cinnamate
TRC-B130433-1G 1 g

Benzyl Cinnamate

Sign In for Pricing
View Details
REST Human Gene Knockout Kit (CRISPR)
KN211570 1 Kit

REST Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PGC Antibody
KC-32366-01 50 μL

PGC Antibody

Sign In for Pricing
View Details
PGC Antibody
KC-32366-02 100 µL

PGC Antibody

Sign In for Pricing
View Details
PGC Antibody
KC-32366-03 1 mL

PGC Antibody

Sign In for Pricing
View Details