Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Elusimicrobium minutum Protein translocase subunit SecF (secF)

This Recombinant Elusimicrobium minutum Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

B2KBZ0

Expression Region

1-321

Origin

Elusimicrobium minutum (strain Pei191)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNLIPKTNFDFLKIRKYFYAVSAIILIAGLICILTRGLNMGIDFKGGTMVQVQFTESIT IDQVRSAVEKYNPEIQSYVGKNTYMIKIKGSQENVNEVRSDVETSLTAAKLKFTVVATDF VGPTVGKDLGERALWALALSLVFMVLYIAFRFQNIIWGTAGVIALIHDAFFMVAAFAFLQ KEFDLVIVAALLTAVGYSINDNIVIFDRMRENIKENPKESFYNIVNRSLNETLSRTVITG STVLIVLVIIYFFGGEVLKNFSLIMLIGVIVGTYSTLFIATPIVYDWAKDSDNFAKTVGN QDVALAAEIKTAKKHNKKKHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF740 conjugate, 0.1mg/mL
BNC742617-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528), CF740 conjugate, 0.1mg/mL
BNC740528-100 1x 100 µL

ZAP70 (ZAP70/528), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL
BNC471199-500 1x 500 µL

SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (ERB2/776), CF594 conjugate, 0.1mg/mL
BNC940776-500 1x 500 µL

HER-2 / CD340 (ERB2/776), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details