Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphatase-related protein type 5 (LPPR5)

This Recombinant Human Lipid phosphate phosphatase-related protein type 5 (LPPR5) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 5, EC= 3.1.3.-, Phosphatidic acid phosphatase 2d, Plasticity-related gene 5 protein, PRG-5

UniProt

Q32ZL2

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRV ESPLEKVTSVQNHITAFAEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPRE2 Protein Vector (Human) (pPM-C-His)
PV025096 500 ng

MAPRE2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
RANBP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1783906 1.0 µg DNA

RANBP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
IL36RN Human shRNA Plasmid Kit (Locus ID 26525)
TR312181 1 Kit

IL36RN Human shRNA Plasmid Kit (Locus ID 26525)

Sign In for Pricing
View Details
Stag3 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4364602 1.0 µg DNA

Stag3 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SKP1 AAV Vector (Human) (CMV)
43845102 1 µg

SKP1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
SFRP2 Antibody (ATTO 700)
abx449694 100 µg

SFRP2 Antibody (ATTO 700)

Sign In for Pricing
View Details