Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphatase-related protein type 5 (LPPR5)

This Recombinant Human Lipid phosphate phosphatase-related protein type 5 (LPPR5) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 5, EC= 3.1.3.-, Phosphatidic acid phosphatase 2d, Plasticity-related gene 5 protein, PRG-5

UniProt

Q32ZL2

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRV ESPLEKVTSVQNHITAFAEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGOH (Mago-nashi Homolog, Proliferation-Associated (Drosophila), MAGOHA) (MaxLight 550)
248414-ML550 100 µL

MAGOH (Mago-nashi Homolog, Proliferation-Associated (Drosophila), MAGOHA) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Polyclonal CABP1 Antibody
NBP3-35834-20ul 20 µL

Rabbit Polyclonal CABP1 Antibody

Sign In for Pricing
View Details
β- Nicotinamide- 8- methylaminoadenine dinucleotide (8-MA-NAD⁺), sodium salt
N 025-05 5x 1 µmol

β- Nicotinamide- 8- methylaminoadenine dinucleotide (8-MA-NAD⁺), sodium salt

Sign In for Pricing
View Details
Cyp7b1 Mouse Pre-designed siRNA Set A
HY-RS18706 1 Set

Cyp7b1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
FBXO25 sgRNA CRISPR Lentivector (Human) (Target 1)
K0765302 1.0 µg DNA

FBXO25 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human SPINK2 activation kit by CRISPRa
GA104591 1 Kit

Human SPINK2 activation kit by CRISPRa

Sign In for Pricing
View Details