Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphatase-related protein type 5 (LPPR5)

This Recombinant Human Lipid phosphate phosphatase-related protein type 5 (LPPR5) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 5, EC= 3.1.3.-, Phosphatidic acid phosphatase 2d, Plasticity-related gene 5 protein, PRG-5

UniProt

Q32ZL2

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRV ESPLEKVTSVQNHITAFAEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMTM7 (NM_138410) Human Untagged Clone
SC324605 10 µg

CMTM7 (NM_138410) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Bothrops jararaca Phospholipase A2
MBS1258765-01 0.02 mg (E-Coli)

Recombinant Bothrops jararaca Phospholipase A2

Sign In for Pricing
View Details
Recombinant Bothrops jararaca Phospholipase A2
MBS1258765-02 0.1 mg (E-Coli)

Recombinant Bothrops jararaca Phospholipase A2

Sign In for Pricing
View Details
Recombinant Bothrops jararaca Phospholipase A2
MBS1258765-03 0.02 mg (Yeast)

Recombinant Bothrops jararaca Phospholipase A2

Sign In for Pricing
View Details
Recombinant Bothrops jararaca Phospholipase A2
MBS1258765-04 0.1 mg (Yeast)

Recombinant Bothrops jararaca Phospholipase A2

Sign In for Pricing
View Details
Recombinant Bothrops jararaca Phospholipase A2
MBS1258765-05 0.02 mg (Baculovirus)

Recombinant Bothrops jararaca Phospholipase A2

Sign In for Pricing
View Details