Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella quintana Type IV secretion system protein virB6 (virB6)

This Recombinant Bartonella quintana Type IV secretion system protein virB6 (virB6) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB6

UniProt

Q6FYW5

Expression Region

1-321

Origin

Bartonella quintana (strain Toulouse) (Rochalimaea quintana)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFSFSPFESISGYILNPLENAMNTTVSGLSSAISAPLNLASIIFIFLYGYNVMTGRVS LSMHSLLNNVVKIVVVTAMATNADTFNTYVKDIFFGDLANAIGNALNSNPASANVFDYIL LKTSARYQEVLAAAWFLEKIMVGLLGSLMIMAVIVFCIGGFIVQMFAQVALVMIIGLGPL FISLYLFNATRKFTDAWITTLINFTILQVLVIMLGTIMCKIILHVLNGTYDSIYFLFPPV VVISIVGAILFRALPGIASALSSGGPYFNAGISSGGQIFTMLSSGAKTGRNAAKSAASTL SGTAGAAAKVAKIGDRGRGRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
Human SP100, N-Twin Strep, C-His, Flag Tag
HA210674-01 20 µg

Human SP100, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human SP100, N-Twin Strep, C-His, Flag Tag
HA210674-02 50 µg

Human SP100, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human SP100, N-Twin Strep, C-His, Flag Tag
HA210674-03 100 µg

Human SP100, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
EGLN2 Rabbit Polyclonal Antibody
AP18002PU-N 400 µL

EGLN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details