Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella quintana Type IV secretion system protein virB6 (virB6)

This Recombinant Bartonella quintana Type IV secretion system protein virB6 (virB6) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB6

UniProt

Q6FYW5

Expression Region

1-321

Origin

Bartonella quintana (strain Toulouse) (Rochalimaea quintana)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFSFSPFESISGYILNPLENAMNTTVSGLSSAISAPLNLASIIFIFLYGYNVMTGRVS LSMHSLLNNVVKIVVVTAMATNADTFNTYVKDIFFGDLANAIGNALNSNPASANVFDYIL LKTSARYQEVLAAAWFLEKIMVGLLGSLMIMAVIVFCIGGFIVQMFAQVALVMIIGLGPL FISLYLFNATRKFTDAWITTLINFTILQVLVIMLGTIMCKIILHVLNGTYDSIYFLFPPV VVISIVGAILFRALPGIASALSSGGPYFNAGISSGGQIFTMLSSGAKTGRNAAKSAASTL SGTAGAAAKVAKIGDRGRGRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMY1A1 (NM_001007526) Human Over-expression Lysate
LC423496 20 µg

RBMY1A1 (NM_001007526) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human IL1F10/IL-38 Protein
PKSH033637-01 20 µg

Recombinant Human IL1F10/IL-38 Protein

Sign In for Pricing
View Details
Recombinant Human IL1F10/IL-38 Protein
PKSH033637-02 100 µg

Recombinant Human IL1F10/IL-38 Protein

Sign In for Pricing
View Details
Apolipoprotein A1 Recombinant Rabbit Monoclonal Antibody [JF0548]
ET1702-23 100 µL

Apolipoprotein A1 Recombinant Rabbit Monoclonal Antibody [JF0548]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152L-01 20 Tests

Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152L-02 100 Tests

Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details