Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein translocase subunit SecF (secF)

This Recombinant Prochlorococcus marinus Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q7VCH2

Expression Region

1-321

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFTPKNLNVKYTFNVSRNRSKVWLISGFAVLISFLGFFFSWTNQSIGFPLRPGFDFTGG TQIILERKCDSECNKITTINISEAFNNAKFSNQETSQKLFDARIQFLDGYKSLLIRSPEL SPSESKEVIESIEFVAGPLEDGGQSVESIGPTLGAKLLQTTLISLLVAFSCVAIYISIRF DRMFSLYALLALFHDVLIVCGVFSWLGIINEVEVNSLFAVALLTIAGYSVNDTVVVFDRI REINKQESRMNFKQKVDFAVSATLTRTLYTSGTTLLPLIALIFFGGTTLYWFAIALALGV VVGSWSSIALVPSLLTLRKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S) -N-Methyl-1-phenyl-2- (pyrrolidin-1-yl) ethanamine
REA50851-01 100 mg

(1S) -N-Methyl-1-phenyl-2- (pyrrolidin-1-yl) ethanamine

Sign In for Pricing
View Details
(1S) -N-Methyl-1-phenyl-2- (pyrrolidin-1-yl) ethanamine
REA50851-02 1 g

(1S) -N-Methyl-1-phenyl-2- (pyrrolidin-1-yl) ethanamine

Sign In for Pricing
View Details
Lrpprc Mouse Gene Knockout Kit (CRISPR)
KN509435 1 Kit

Lrpprc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neuropeptide Y (3-36) (porcine)
orb2694018-01 5 mg

Neuropeptide Y (3-36) (porcine)

Sign In for Pricing
View Details
Neuropeptide Y (3-36) (porcine)
orb2694018-02 10 mg

Neuropeptide Y (3-36) (porcine)

Sign In for Pricing
View Details
NT5E Antibody
OAAF08100-100UG 100 µg

NT5E Antibody

Sign In for Pricing
View Details