Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein translocase subunit SecF (secF)

This Recombinant Prochlorococcus marinus Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q7VCH2

Expression Region

1-321

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFTPKNLNVKYTFNVSRNRSKVWLISGFAVLISFLGFFFSWTNQSIGFPLRPGFDFTGG TQIILERKCDSECNKITTINISEAFNNAKFSNQETSQKLFDARIQFLDGYKSLLIRSPEL SPSESKEVIESIEFVAGPLEDGGQSVESIGPTLGAKLLQTTLISLLVAFSCVAIYISIRF DRMFSLYALLALFHDVLIVCGVFSWLGIINEVEVNSLFAVALLTIAGYSVNDTVVVFDRI REINKQESRMNFKQKVDFAVSATLTRTLYTSGTTLLPLIALIFFGGTTLYWFAIALALGV VVGSWSSIALVPSLLTLRKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD7 antibody - middle region (ARP53738_P050)
ARP53738_P050 100 µL

ANKRD7 antibody - middle region (ARP53738_P050)

Sign In for Pricing
View Details
TRAF3IP3 Protein Vector (Rat) (pPM-C-HA)
PV312676 500 ng

TRAF3IP3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ARP3 Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1598459 100 µL

ARP3 Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
Sct (NM_011328) Mouse Recombinant Protein
PM42622M5 20 µg

Sct (NM_011328) Mouse Recombinant Protein

Sign In for Pricing
View Details
P2RY6 293 Cell Lysate
408483 0.1 mg

P2RY6 293 Cell Lysate

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Anaphase-promoting complex subunit 1 (APC1) , partial
MBS1147671 Inquire

Recombinant Saccharomyces cerevisiae Anaphase-promoting complex subunit 1 (APC1) , partial

Sign In for Pricing
View Details