Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein translocase subunit SecF (secF)

This Recombinant Prochlorococcus marinus Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q7VCH2

Expression Region

1-321

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFTPKNLNVKYTFNVSRNRSKVWLISGFAVLISFLGFFFSWTNQSIGFPLRPGFDFTGG TQIILERKCDSECNKITTINISEAFNNAKFSNQETSQKLFDARIQFLDGYKSLLIRSPEL SPSESKEVIESIEFVAGPLEDGGQSVESIGPTLGAKLLQTTLISLLVAFSCVAIYISIRF DRMFSLYALLALFHDVLIVCGVFSWLGIINEVEVNSLFAVALLTIAGYSVNDTVVVFDRI REINKQESRMNFKQKVDFAVSATLTRTLYTSGTTLLPLIALIFFGGTTLYWFAIALALGV VVGSWSSIALVPSLLTLRKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Pertussis rpsB Protein (aa 1-249)
VAng-Lsx4713-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Pertussis rpsB Protein (aa 1-249)

Sign In for Pricing
View Details
Mouse Monoclonal Lipocalin-2/NGAL Antibody (56) [Janelia Fluor 549]
NBP2-41366JF549 0.1 mL

Mouse Monoclonal Lipocalin-2/NGAL Antibody (56) [Janelia Fluor 549]

Sign In for Pricing
View Details
MetAP1 Antibody Blocking Peptide
orb1508918 500 µg

MetAP1 Antibody Blocking Peptide

Sign In for Pricing
View Details
TRIM36 (Tripartite Motif-Containing 36, HAPRIN, RBCC728, RNF98) (HRP)
MBS6182785-01 0.1 mL

TRIM36 (Tripartite Motif-Containing 36, HAPRIN, RBCC728, RNF98) (HRP)

Sign In for Pricing
View Details
TRIM36 (Tripartite Motif-Containing 36, HAPRIN, RBCC728, RNF98) (HRP)
MBS6182785-02 5x 0.1 mL

TRIM36 (Tripartite Motif-Containing 36, HAPRIN, RBCC728, RNF98) (HRP)

Sign In for Pricing
View Details
STAT6 Rabbit Polyclonal Antibody (AP)
orb911910 100 µL

STAT6 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details