Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphatase-related protein type 5 (Lppr5)

This Recombinant Mouse Lipid phosphate phosphatase-related protein type 5 (Lppr5) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 5, EC= 3.1.3.-, Plasticity-related gene 5 protein, PRG-5

UniProt

Q8BJ52

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAATYLTMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQPENGHIHRDNVARMPMTNIPRV ESPLEKVTSLQNHVTAFAEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCC1 CRISPR Activation Plasmid (m)
sc-427294-ACT 20 µg

ASCC1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) GLTK Polyclonal Antibody
MBS7163912 Inquire

Rabbit anti-Escherichia coli (strain K12) GLTK Polyclonal Antibody

Sign In for Pricing
View Details
PKC alpha Rabbit pAb
A0267-01 20 µL

PKC alpha Rabbit pAb

Sign In for Pricing
View Details
PKC alpha Rabbit pAb
A0267-02 100 μL

PKC alpha Rabbit pAb

Sign In for Pricing
View Details
PKC alpha Rabbit pAb
A0267-03 1000 μL

PKC alpha Rabbit pAb

Sign In for Pricing
View Details
PKC alpha Rabbit pAb
A0267-04 500 μL

PKC alpha Rabbit pAb

Sign In for Pricing
View Details