Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphatase-related protein type 5 (Lppr5)

This Recombinant Mouse Lipid phosphate phosphatase-related protein type 5 (Lppr5) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 5, EC= 3.1.3.-, Plasticity-related gene 5 protein, PRG-5

UniProt

Q8BJ52

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAATYLTMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQPENGHIHRDNVARMPMTNIPRV ESPLEKVTSLQNHVTAFAEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF149 Double Nickase Plasmid (m)
sc-426694-NIC 20 µg

RNF149 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Prokaryotic Human Protocadherin Alpha 13
RPU60196-01 50 µg

Prokaryotic Human Protocadherin Alpha 13

Sign In for Pricing
View Details
Prokaryotic Human Protocadherin Alpha 13
RPU60196-02 100 µg

Prokaryotic Human Protocadherin Alpha 13

Sign In for Pricing
View Details
Prokaryotic Human Protocadherin Alpha 13
RPU60196-03 1 mg

Prokaryotic Human Protocadherin Alpha 13

Sign In for Pricing
View Details
PENK Polyclonal Antibody
RD83722A-01 60μL

PENK Polyclonal Antibody

Sign In for Pricing
View Details
PENK Polyclonal Antibody
RD83722A-02 120μL

PENK Polyclonal Antibody

Sign In for Pricing
View Details