Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae Type IV secretion system protein virB6 (virB6)

This Recombinant Bartonella henselae Type IV secretion system protein virB6 (virB6) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB6

UniProt

Q9RND2

Expression Region

1-321

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFSFSPFESISGYILQPLNNVMNTTVSGLSSAISAPLNLASIIFIFLYGYNVMTGRVA LSMNSLLNNVVKIVIVTTMATNADTFNTYVKNIFFGDLANAIGNALNSNPSSANVFDYIL LKTSARYQEVLAAAWFLEKIMVGLLGSLMIMAVIVFCIGGFIVQMFAQVALVMIIGLGPL FISLYLFNATRKFTDAWITTLVNFTILQVLVIMLGTIMCKIILYVLDGTYESIYFLFPPV VVISIVGAILFRALPGIASALSSGGPYFNAGISSGGQIFTMLSSGAKTGRNAAKSAASTL SGAAGTATKAAKIGGNGRGRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF647 conjugate, 0.1mg/mL
BNC471974-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS716815 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
FOXD3 Antibody
8C11862-AAT 50 µg

FOXD3 Antibody

Sign In for Pricing
View Details
RABEP1 (NM_004703) Human Recombinant Protein
TP308056L 1 mg

RABEP1 (NM_004703) Human Recombinant Protein

Sign In for Pricing
View Details
Glucokinase (GCK) (NM_000162) Human Over-expression Lysate
LY400059 100 µg

Glucokinase (GCK) (NM_000162) Human Over-expression Lysate

Sign In for Pricing
View Details
MRPS24 (Center) Rabbit Polyclonal Antibody
AP52753PU-N 400 µL

MRPS24 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details