Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Protein translocase subunit SecF (secF)

This Recombinant Synechococcus sp. Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

B1XQC0

Expression Region

1-323

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFKFSVIKQRLLWWSISAIAILASVLFMGISFNQLQAPLRPSLDFVGGTKIQVALDCTV AGNCTDPLETATIQNVVNNQGVGSSTVQILGQERTTFSVRTPQLDVDQRSRLLDALESEV GALDPGTIQIDSVGPTIGRELFVQGMLALLVSFFGIIVYLSIRFQFDYALFAIAALFHDV LVTAGVFALLGLVLGVEVDSLFLVALLTIIGFSVNDTVVIYDRVRENLKADEGDNIDQVV DHSVQQTLGRSINTTLTTLLPLVAIFLFGGSTLKFFALALIIGFICGSYSSIFVASTLLA WWRNRNGQPPTVTKEAVNVTELS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Euparol (mounting media) For Microscopy
01198 00100 100 mL

Euparol (mounting media) For Microscopy

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)
MBS1419014-01 0.02 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)
MBS1419014-02 0.1 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)
MBS1419014-03 0.02 mg (Yeast)

Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)
MBS1419014-04 0.1 mg (Yeast)

Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)
MBS1419014-05 0.02 mg (Baculovirus)

Recombinant Rhizobium leguminosarum bv. viciae Xanthine phosphoribosyltransferase (gpt)

Sign In for Pricing
View Details