Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase (SLS2)

This Recombinant Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase (SLS2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase, TbSLS2, EC= 2.7.8.-, Ethanolamine-phosphorylceramide synthase, EPC synthase, Sphingolipid synthase

UniProt

B3A0M0

Expression Region

1-323

Origin

Trypanosoma brucei brucei

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILVVALQITHERMPDPKVTKP LPDLGFELLTKVPGMYVLADCCIGFLNILSVFTAFKLYLLHRHCVGSGEPELPCNIPGVS RFFLSVWLCKENCRIELRNIHTIAWIRFITSYALLLLSRSIIMVVTSLPNPDDLCQNPPK IENRVKDILLTVLTAGAGSIHCGDLMYSGHTVILTLHLMFHWIYGAMVHWSFRPVVTVVA IFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQLQLFIRWWPCCGANSREV AEDGVPVAIVIKNEEMMNFEGKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bicyclo Prostaglandin E1
sc-221356 1 mg

Bicyclo Prostaglandin E1

Sign In for Pricing
View Details
Cyclosporin AM 4N-D3
TRC-C989412-50MG 50 mg

Cyclosporin AM 4N-D3

Sign In for Pricing
View Details
HES1 Rabbit pAb, RBITC conjugated
orb2422849 100 µL

HES1 Rabbit pAb, RBITC conjugated

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) rsgA Polyclonal Antibody
MBS7186920 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) rsgA Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human VSIG4  Monoclonal Antibody
MBS2544345-01 0.06 mL

Rabbit anti Human VSIG4  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human VSIG4  Monoclonal Antibody
MBS2544345-02 0.12 mL

Rabbit anti Human VSIG4  Monoclonal Antibody

Sign In for Pricing
View Details