Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Protein translocase subunit SecF (secF)

This Recombinant Helicobacter pylori Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

O26073

Expression Region

1-323

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELFKRTRILSFMRYSNYGVIVSAILALLALGLLFFKGFSLGIDFAGGSLVQVRYTQNAP IKEVRDLFEKEARFKGVQVSEFGSKEEILIKFPFVETAENEDLNAIVANILKPSGDFEIR KFDTVGPRVGSELKEKGILSLILALIAIMVYVSFRYEWRFALASVIALVHDVILVASSVI VFKIDMNLEVIAALLTLIGYSINDTIIIFDRIREEMLSQKTKNATQAIDEAISSTLTRTL LTSLTVFFVVLILCVFGSKIIIGFSLPMLIGTIVGTYSSIFIAPKVALLLGFDMDKYYEN ETRKIKKAQEKEKMRRLYESGQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant M6PR Antibody
RC-16202-01 50 μL

Recombinant M6PR Antibody

Sign In for Pricing
View Details
Recombinant M6PR Antibody
RC-16202-02 100 µL

Recombinant M6PR Antibody

Sign In for Pricing
View Details
Recombinant M6PR Antibody
RC-16202-03 1 mL

Recombinant M6PR Antibody

Sign In for Pricing
View Details
(S)-(+)-Clobenzorex Hydrochloride (1.0mg/ml in Acetonitrile)
TRC-KIT3735-1X1ML 1 mL

(S)-(+)-Clobenzorex Hydrochloride (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
DOCK8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D7]
TA801863AM 100 µL

DOCK8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D7]

Sign In for Pricing
View Details
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7C7]
CF806789 100 µg

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7C7]

Sign In for Pricing
View Details