Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 165 (Tmem165)

This Recombinant Rat Transmembrane protein 165 (Tmem165) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Transmembrane protein 165, Transmembrane protein TPARL

UniProt

Q4V899

Expression Region

1-323

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASARGSGRAPTRRLLVLLLLPLLWAPAGVRAGPEEDLSHRNQEPPAPAQQLQPQPAAV QGLEPARAEKGFTPAAPVHTNREDAATQANLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIPQKKWLHFISPIFVQAL TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVT IIGGIVFLAFAFSALFISPESGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDPD5 (NM_030792) Human Over-expression Lysate
LS081544-20ug 20 µg

GDPD5 (NM_030792) Human Over-expression Lysate

Sign In for Pricing
View Details
Thieno[3,2-B]pyridine-6-carboxylic acid
SEA39039-01 250 mg

Thieno[3,2-B]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
Thieno[3,2-B]pyridine-6-carboxylic acid
SEA39039-02 2.5 g

Thieno[3,2-B]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi GTPase obg (obg)
MBS1184195-01 0.02 mg (E-Coli)

Recombinant Borrelia burgdorferi GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi GTPase obg (obg)
MBS1184195-02 0.02 mg (Yeast)

Recombinant Borrelia burgdorferi GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi GTPase obg (obg)
MBS1184195-03 0.1 mg (E-Coli)

Recombinant Borrelia burgdorferi GTPase obg (obg)

Sign In for Pricing
View Details