Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Probable mitochondrial thiamine pyrophosphate carrier (mcfK)

This Recombinant Dictyostelium discoideum Probable mitochondrial thiamine pyrophosphate carrier (mcfK) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Probable mitochondrial thiamine pyrophosphate carrier, Mitochondrial substrate carrier family protein K, Solute carrier family 25 member 19 homolog

UniProt

Q54VS7

Expression Region

1-323

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIITTSNDEDKKTNVFVELAAGSFSGALTRFIVAPLDVVKIRLQLQRTQLNNNSNNNNKI IGKENVNYRGIINTMSKVIREEGIRSLWKGNFSAELLWVTYAAIQFSTYNEIIGILDPEY RKHQQRTDKDKPNYKPSSSITMIGGASAGILSTIVSYPFDIIRTNIVNNHNKTNFKQTFK TIIARNGGYSNLFSGINSSLFQIVPQMGFQFTFYETFKFISNKYTSSVNNNNNNPLNQFT CGLLSGAISKFLVLPFDVVKKRLQVNEKVGYGMKSCFRDLYFNEGGVKAFFKGGTPGIVK AGLAAALSFTFFEQSKRILLNKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF405S conjugate, 0.1mg/mL
BNC040821-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details