Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Probable mitochondrial thiamine pyrophosphate carrier (mcfK)

This Recombinant Dictyostelium discoideum Probable mitochondrial thiamine pyrophosphate carrier (mcfK) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Probable mitochondrial thiamine pyrophosphate carrier, Mitochondrial substrate carrier family protein K, Solute carrier family 25 member 19 homolog

UniProt

Q54VS7

Expression Region

1-323

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIITTSNDEDKKTNVFVELAAGSFSGALTRFIVAPLDVVKIRLQLQRTQLNNNSNNNNKI IGKENVNYRGIINTMSKVIREEGIRSLWKGNFSAELLWVTYAAIQFSTYNEIIGILDPEY RKHQQRTDKDKPNYKPSSSITMIGGASAGILSTIVSYPFDIIRTNIVNNHNKTNFKQTFK TIIARNGGYSNLFSGINSSLFQIVPQMGFQFTFYETFKFISNKYTSSVNNNNNNPLNQFT CGLLSGAISKFLVLPFDVVKKRLQVNEKVGYGMKSCFRDLYFNEGGVKAFFKGGTPGIVK AGLAAALSFTFFEQSKRILLNKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamate-Rich WD Repeat-Containing Protein 1 (GRWD1) Antibody
abx004612-01 100 µL

Glutamate-Rich WD Repeat-Containing Protein 1 (GRWD1) Antibody

Sign In for Pricing
View Details
Glutamate-Rich WD Repeat-Containing Protein 1 (GRWD1) Antibody
abx004612-02 200 µL

Glutamate-Rich WD Repeat-Containing Protein 1 (GRWD1) Antibody

Sign In for Pricing
View Details
Human PDG (Pregnanediol-3-Glucuronide) ELISA Kit
EH4118 96 Tests

Human PDG (Pregnanediol-3-Glucuronide) ELISA Kit

Sign In for Pricing
View Details
MS4A1 Antibody
orb418666-01 50 μL

MS4A1 Antibody

Sign In for Pricing
View Details
MS4A1 Antibody
orb418666-02 100 µL

MS4A1 Antibody

Sign In for Pricing
View Details
Phospho-RSK1 p90 (Thr359/Ser363) polyclonal antibody
orb1725363-01 50 µL

Phospho-RSK1 p90 (Thr359/Ser363) polyclonal antibody

Sign In for Pricing
View Details