Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial glutamate carrier 1 (Slc25a22)

This Recombinant Mouse Mitochondrial glutamate carrier 1 (Slc25a22) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Mitochondrial glutamate carrier 1, GC-1, Glutamate/H (+) symporter 1, Solute carrier family 25 member 22

UniProt

Q9D6M3

Expression Region

1-323

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRMYASMSDCLIKTIRSE GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLPKEMLAGCGAGTCQVIV TTPMEMLKIQLQDAGRIAAQRKILAAQAQLSAQGGAQPSVEAPAPPRPTATQLTRDLLRN HGIAGLYKGLGATLLRDVPFSIVYFPLFANLNQLGRPSSEEKSPFYVSFLAGCVAGSAAA VAVNPCDVVKTRLQSLERGVNEDTYSGFLDCARKIWRHEGPSAFLKGAYCRALVIAPLFG IAQVVYFLGIAESLLGLLQEPQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details