Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Aquaporin-4 (Aqp4)

This Recombinant Rat Aquaporin-4 (Aqp4) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Aquaporin-4, AQP-4, Mercurial-insensitive water channel, MIWC, WCH4

UniProt

P47863

Expression Region

1-323

Origin

Rattus norvegicus (Rat)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDGAAARRWGKCGPPCSRESIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTINWG GSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIT AQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDS KRTDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG AVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVH VIDIDRGDEKKGKDSSGEVLSSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL
BNC941855-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF568 conjugate, 0.1mg/mL
BNC681993-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP/872), CF568 conjugate, 0.1mg/mL
BNC680872-100 1x 100 µL

Retinol Binding Protein-1 (RBP/872), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details