Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 165 (Tmem165)

This Recombinant Mouse Transmembrane protein 165 (Tmem165) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Transmembrane protein 165, TPA-regulated locus protein, Transmembrane protein PFT27, Transmembrane protein TPARL

UniProt

P52875

Expression Region

1-323

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPAQQLQPQPAAV QGLEPARAEKGLTPVAPVHTNKEDAAAQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIPQKKWLHFISPIFVQAL TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVT IIGGIVFLAFAFSALFISPESGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fusidic Acid Sodium Salt
TRC-F865505-1G 1 g

Fusidic Acid Sodium Salt

Sign In for Pricing
View Details
EnzyFluo™ Human/Mouse RB (T821/826) Phosphorylation ELISA Kit
ERBT-100 100 Tests

EnzyFluo™ Human/Mouse RB (T821/826) Phosphorylation ELISA Kit

Sign In for Pricing
View Details
Primer Panel
HPP6016C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: transverse
CS506139 5x 5 µm

Frozen Tissue Sections, Colon: transverse

Sign In for Pricing
View Details
Tissue FFPE Sections, Seminal vesicle
CS701495 5x 5 µm

Tissue FFPE Sections, Seminal vesicle

Sign In for Pricing
View Details
C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF807163 100 µg

C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details