Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein translocase subunit SecF (secF)

This Recombinant Escherichia coli Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

P0AG93

Expression Region

1-323

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRGFNWGLDFTGGTVIEI TLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGETGGQVLGSQVLKVINE STNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGFRFEWRLAAGVVIALAHD VIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIRENFRKIRRGTPYEIFNVS LTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGVSIGTASSIYVASALALKLG MKREHMLQQKVEKEGADQPSILP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TKT, 1-623aa, Human, His tag, E Coli
MBS204357-01 0.01 mg

TKT, 1-623aa, Human, His tag, E Coli

Sign In for Pricing
View Details
TKT, 1-623aa, Human, His tag, E Coli
MBS204357-02 0.05 mg

TKT, 1-623aa, Human, His tag, E Coli

Sign In for Pricing
View Details
TKT, 1-623aa, Human, His tag, E Coli
MBS204357-03 5x 0.01 mg

TKT, 1-623aa, Human, His tag, E Coli

Sign In for Pricing
View Details
TKT, 1-623aa, Human, His tag, E Coli
MBS204357-04 0.25 mg

TKT, 1-623aa, Human, His tag, E Coli

Sign In for Pricing
View Details
TKT, 1-623aa, Human, His tag, E Coli
MBS204357-05 5x 0.05 mg

TKT, 1-623aa, Human, His tag, E Coli

Sign In for Pricing
View Details
TKT, 1-623aa, Human, His tag, E Coli
MBS204357-06 5x 0.25 mg

TKT, 1-623aa, Human, His tag, E Coli

Sign In for Pricing
View Details