Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

P21634

Expression Region

1-323

Origin

Pseudomonas denitrificans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSETILLILALALVIDRVVGDPDWLWARVPHPVVFFGKAIGFFDARLNREDLEDSARKFR GVVAILLLLGISAWFGHLLHRLFAVLGPLGFLLEAVLVAVFLAQKSLADHVRRVAGGLRQ GGLEGGRAAVSMIVGRDPKTLDEPAVCRAAIESLAENFSDGVVAPAFWYAVAGLPGLLAY KMLNTADSMIGHKSPKYLHFGWASARLDDLANLPAARLSILLISAGALIHRGASAAKDAL TVALRDHGLHRSPNSGWPEAAMAGALDLQLAGPRIYGGVKVSEPMINGPGRAVATSEDID AGIAVFYGACTVMAGFVLAIAMI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ12331 (NM_024986) Human Tagged Lenti ORF Clone
RC211166L4 10 µg

FLJ12331 (NM_024986) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human POLR1E shRNA (UAS) - Lentiviral human POLR1E shRNA (UAS, iRFP) (25)
GTR15312377 1 Vial

Lentiviral human POLR1E shRNA (UAS) - Lentiviral human POLR1E shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ATP5SL Lentiviral Activation Particles (h2)
sc-412447-LAC-2 200 µL

ATP5SL Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
SUN1 Protein Vector (Rat) (pPM-C-His)
PV308985 500 ng

SUN1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal mPlum Antibody [Alexa Fluor 350]
NBP3-11833AF350 0.1 mL

Rabbit Polyclonal mPlum Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
AATF Antibody
orb1277059 100 µL

AATF Antibody

Sign In for Pricing
View Details