Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

P21634

Expression Region

1-323

Origin

Pseudomonas denitrificans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSETILLILALALVIDRVVGDPDWLWARVPHPVVFFGKAIGFFDARLNREDLEDSARKFR GVVAILLLLGISAWFGHLLHRLFAVLGPLGFLLEAVLVAVFLAQKSLADHVRRVAGGLRQ GGLEGGRAAVSMIVGRDPKTLDEPAVCRAAIESLAENFSDGVVAPAFWYAVAGLPGLLAY KMLNTADSMIGHKSPKYLHFGWASARLDDLANLPAARLSILLISAGALIHRGASAAKDAL TVALRDHGLHRSPNSGWPEAAMAGALDLQLAGPRIYGGVKVSEPMINGPGRAVATSEDID AGIAVFYGACTVMAGFVLAIAMI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM5 CRISPR All-in-one AAV vector set (with saCas9)(Human)
38642151 3x 1.0 µg DNA

RBM5 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Mouse Hax1 qPCR Primer Pair
QM24026S 200 Tests

Mouse Hax1 qPCR Primer Pair

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Llama IgG (H+L) Secondary Antibody [DyLight 550]
NBP1-75084R 0.5 mL

Goat Polyclonal Goat anti-Llama IgG (H+L) Secondary Antibody [DyLight 550]

Sign In for Pricing
View Details
Ccl7 3'UTR Luciferase Stable Cell Line
TU201875 1.0 mL

Ccl7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TDGF1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46437111 3x 1.0 µg

TDGF1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human CTGF Protein, Untagged, E.coli-20ug
QP5373-20ug 20ug

Recombinant Human CTGF Protein, Untagged, E.coli-20ug

Sign In for Pricing
View Details