Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstC 2 (pstC2)

This Recombinant Phosphate transport system permease protein pstC 2 (pstC2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC 2

UniProt

P0A631

Expression Region

1-324

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTEPLTKPALVAVDMRPARRGERLFKLAASAAGSTIVIAILLIAIFLLVRAVPSLRANH ANFFTSTQFDTSDDEQLAFGVRDLFMVTALSSITALVLAVPVAVGIAVFLTHYAPRRLSR PFGAMVDLLAAVPSIIFGLWGIFVLAPKLEPIARFLNRNLGWLFLFKQGNVSLAGGGTIF TAGIVLSVMILPIVTSISREVFRQTPLIQIEAALALGATKWEVVRMTVLPYGRSGVVAAS MLGLGRALGETVAVLVILRSAARPGTWSLFDGGYTFASKIASAASEFSEPLPTGAYISAG FALFVLTFLVNAAARAIAGGKVNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), CF647 conjugate, 0.1mg/mL
BNC472001-500 1x 500 µL

IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
9,10-Dihydro-1-benzo[a]pyrene-7(8H)-one Oxime
TRC-D448425-50MG 50 mg

9,10-Dihydro-1-benzo[a]pyrene-7(8H)-one Oxime

Sign In for Pricing
View Details
Paxillin Antibody
KC-43722-01 50 μL

Paxillin Antibody

Sign In for Pricing
View Details
Paxillin Antibody
KC-43722-02 100 µL

Paxillin Antibody

Sign In for Pricing
View Details
Paxillin Antibody
KC-43722-03 1 mL

Paxillin Antibody

Sign In for Pricing
View Details
Anti-CD4 (GK1.5) In Vivo Antibody - Low Endotoxin
ICH1042-25mg 25 mg

Anti-CD4 (GK1.5) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details