Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstC 2 (pstC2)

This Recombinant Phosphate transport system permease protein pstC 2 (pstC2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC 2

UniProt

P0A630

Expression Region

1-324

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTEPLTKPALVAVDMRPARRGERLFKLAASAAGSTIVIAILLIAIFLLVRAVPSLRANH ANFFTSTQFDTSDDEQLAFGVRDLFMVTALSSITALVLAVPVAVGIAVFLTHYAPRRLSR PFGAMVDLLAAVPSIIFGLWGIFVLAPKLEPIARFLNRNLGWLFLFKQGNVSLAGGGTIF TAGIVLSVMILPIVTSISREVFRQTPLIQIEAALALGATKWEVVRMTVLPYGRSGVVAAS MLGLGRALGETVAVLVILRSAARPGTWSLFDGGYTFASKIASAASEFSEPLPTGAYISAG FALFVLTFLVNAAARAIAGGKVNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS804230 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mouse Inhbe activation kit by CRISPRa
GA202168 1 Kit

Mouse Inhbe activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823M-01 25 µg

Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823M-02 100 µg

Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
CTP synthase (CTPS1) Human Gene Knockout Kit (CRISPR)
KN202434BN 1 Kit

CTP synthase (CTPS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,4-Dichloro-6-nitroaniline
TRC-D435165-250MG 250 mg

2,4-Dichloro-6-nitroaniline

Sign In for Pricing
View Details