Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Protein translocase subunit SecF (secF)

This Recombinant Rhodobacter sphaeroides Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

O33568

Expression Region

1-324

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFRLKLCPEKTNIDFFWAAPVTFGFSVFLMAASLVAWLTLGLNFGIDFRGGTTIRTEST QAVDVAAYRAALEGQDLGDISITEVFDPGFRADQHVAMVRIGAQDATQSITPEQIGQVEE ALKTVDPSITFPSVESVGPKVSGELIRSAILAVAAACAGIAVYIWLRFEWQFALGSVAAL IHDVLVTIGVFALFQIKFDLTTVAALLTVLGYSINDTVVVFDRLRENLVKYKTMPLRDVM NLSVNETLSRTIMTLMTTLIALVSLLVFGGDVIRGFVFAITFGVVIGTYSSVYMAKNIVL YLGVDRGGPKKDSKAGTQFANIDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Rabbit pAb, BF700 conjugated
orb2867168 100 µL

P53 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Heating Mantle (BER-4803)
BER-4803 1 Unit

Heating Mantle (BER-4803)

Sign In for Pricing
View Details
Anti-Mouse WDR35 (KIAA1336), Rabbit Polyclonal
MKA1336 Inquire

Anti-Mouse WDR35 (KIAA1336), Rabbit Polyclonal

Sign In for Pricing
View Details
CRTAP Adenovirus (Human)
16865051 1.0 mL

CRTAP Adenovirus (Human)

Sign In for Pricing
View Details
VENTX Human siRNA Oligo Duplex (Locus ID 27287)
SR309064 1 Kit

VENTX Human siRNA Oligo Duplex (Locus ID 27287)

Sign In for Pricing
View Details
Stat2 Polyclonal Antibody
MBS8519596-01 0.1 mg

Stat2 Polyclonal Antibody

Sign In for Pricing
View Details