Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 165 (TMEM165)

This Recombinant Human Transmembrane protein 165 (TMEM165) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Transmembrane protein 165, Transmembrane protein PT27, Transmembrane protein TPARL

UniProt

Q9HC07

Expression Region

1-324

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAV QGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQA LTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTV TIIGGIVFLAFAFSALFISPDSGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike Protein, Biotinylated (RBD, Avi-His Tag)
PKSR030535 20 µg

Recombinant SARS-CoV-2 Spike Protein, Biotinylated (RBD, Avi-His Tag)

Sign In for Pricing
View Details
STAM2 Rabbit Polyclonal Antibody
TA362106 100 µL

STAM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Crude Limulus polyphemus Lectin (Horseshoe Crab) -LPA-
L-1500-1 1 mL

Crude Limulus polyphemus Lectin (Horseshoe Crab) -LPA-

Sign In for Pricing
View Details
MMGT1 Mouse Monoclonal Antibody [Clone ID: OTI10A12]
CF811121 100 µg

MMGT1 Mouse Monoclonal Antibody [Clone ID: OTI10A12]

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgG
HAF-011-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgG

Sign In for Pricing
View Details
EIF3E (NM_001568) Human Over-expression Lysate
LY400602 100 µg

EIF3E (NM_001568) Human Over-expression Lysate

Sign In for Pricing
View Details