Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 165 (TMEM165)

This Recombinant Human Transmembrane protein 165 (TMEM165) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Transmembrane protein 165, Transmembrane protein PT27, Transmembrane protein TPARL

UniProt

Q9HC07

Expression Region

1-324

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAV QGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQA LTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTV TIIGGIVFLAFAFSALFISPDSGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK4 (NM_031417) Human Over-expression Lysate
LY403112 100 µg

MARK4 (NM_031417) Human Over-expression Lysate

Sign In for Pricing
View Details
Perp (NM_022032) Mouse Recombinant Protein
TP501877 20 µg

Perp (NM_022032) Mouse Recombinant Protein

Sign In for Pricing
View Details
Sch 58053
TRC-S199950-1MG 1 mg

Sch 58053

Sign In for Pricing
View Details
Primer Panel
HPP6003B 10x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
Anxa13 Mouse Gene Knockout Kit (CRISPR)
KN501333 1 Kit

Anxa13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGFBP4 (N-term) Rabbit Polyclonal Antibody
AP17493PU-N 400 µL

IGFBP4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details