Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorophyll a/b light-harvesting protein pcb (pcb)

This Recombinant Chlorophyll a/b light-harvesting protein pcb (pcb) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Chlorophyll a/b light-harvesting protein pcb

UniProt

Q9F487

Expression Region

1-324

Origin

Fischerella muscicola

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAISTDKTFAANTNSPWLIGNARLIDLSGQLLGAHIAHAGLIMFWAGSITISEVTRFVPG IPMYEQQMTLLPHLATLGWGVGAGGEVINTYPYFVIGILHLVASAVLGAGGLFHVFRSPA ILYNSGGQVAKFHYEWNDPKKLGLILGHHLIILGFGAFLLVLKAMFFGGIYDTHIENVRL ITNPTFDPMTIFSYLVGIKDSHWTLLGIASVDNLEDVIGGHIWIGSILILGGIWHILVPP FAWVRQILPIVNGEEILSYSLLGLALMAFISAVFVGYNDTVFPKEFYGENRIVIATIQWV LGILALVGYFWHSWRSRELNSNLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc23/APC8 Rabbit mAb
MBS9470069-01 0.05 mL

Cdc23/APC8 Rabbit mAb

Sign In for Pricing
View Details
Cdc23/APC8 Rabbit mAb
MBS9470069-02 0.1 mL

Cdc23/APC8 Rabbit mAb

Sign In for Pricing
View Details
Cdc23/APC8 Rabbit mAb
MBS9470069-03 5x 0.1 mL

Cdc23/APC8 Rabbit mAb

Sign In for Pricing
View Details
ZNF233 Protein Vector (Human) (pPB-C-His)
PV144762 500 ng

ZNF233 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
L- (2S,3aS,7aS) -Octahydro-1H-indole-2-carboxylic Acid
O5450-30 1 g

L- (2S,3aS,7aS) -Octahydro-1H-indole-2-carboxylic Acid

Sign In for Pricing
View Details
SETX Antibody, Biotin conjugated
CSB-PA800097LD01HU-01 50 µg

SETX Antibody, Biotin conjugated

Sign In for Pricing
View Details