Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstC (pstC)

This Recombinant Phosphate transport system permease protein pstC (pstC) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC

UniProt

Q9PBK2

Expression Region

1-324

Origin

Xylella fastidiosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSTLIPKETSTPGGRDLRDARADYFFKLLLTAAVAFVLIALVSAALSMLWGGRQALQLQ GVSFFYSTEWNPVENKYGALTPIYGTIVTALIAMLIAVPVSFGIAFFLTEVAPRWLRRPV GTAIELLAGIPSIIYGMWGLFVLVPVMTDYITPFLNDHIGTLPLIGTLFQGPPLGIGTLS AGFVLAIMVIPFISSIMREVFLTVPTQLKESAYALGSTKWEVSWNIVLPYTRSAVIGGMF LGLGRALGETMAVAFVIGNSVRLSPSLLTPGTTIAALIANDFGEATESYRSALLLLGFVL FIVTFAVLVIARLMLLRLSRKEGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOT1L Mouse Monoclonal Antibody [Clone ID: OTI11H2]
TA802741 100 µL

DOT1L Mouse Monoclonal Antibody [Clone ID: OTI11H2]

Sign In for Pricing
View Details
Lentiviral human CAMTA1 shRNA (UAS) - Lentiviral human CAMTA1 shRNA (UAS, RFP) (25)
GTR15346454 1 Vial

Lentiviral human CAMTA1 shRNA (UAS) - Lentiviral human CAMTA1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
KLF8 antibody - middle region
MBS3201209-01 0.1 mL

KLF8 antibody - middle region

Sign In for Pricing
View Details
KLF8 antibody - middle region
MBS3201209-02 5x 0.1 mL

KLF8 antibody - middle region

Sign In for Pricing
View Details
GPR25 cDNA Clone
MBS1269483-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

GPR25 cDNA Clone

Sign In for Pricing
View Details
GPR25 cDNA Clone
MBS1269483-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

GPR25 cDNA Clone

Sign In for Pricing
View Details