Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstC (pstC)

This Recombinant Phosphate transport system permease protein pstC (pstC) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC

UniProt

Q9PBK2

Expression Region

1-324

Origin

Xylella fastidiosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSTLIPKETSTPGGRDLRDARADYFFKLLLTAAVAFVLIALVSAALSMLWGGRQALQLQ GVSFFYSTEWNPVENKYGALTPIYGTIVTALIAMLIAVPVSFGIAFFLTEVAPRWLRRPV GTAIELLAGIPSIIYGMWGLFVLVPVMTDYITPFLNDHIGTLPLIGTLFQGPPLGIGTLS AGFVLAIMVIPFISSIMREVFLTVPTQLKESAYALGSTKWEVSWNIVLPYTRSAVIGGMF LGLGRALGETMAVAFVIGNSVRLSPSLLTPGTTIAALIANDFGEATESYRSALLLLGFVL FIVTFAVLVIARLMLLRLSRKEGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dendronobilin B
HY-N12573 1 Each

Dendronobilin B

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae ihfB Protein (aa 1-104)
VAng-Wyb2166-1mgEcoli 1 mg (E. coli)

Recombinant Neisseria Gonorrhoeae ihfB Protein (aa 1-104)

Sign In for Pricing
View Details
Lentiviral human ADGRB2 sgRNA gene knockout kit - Lentiviral human ADGRB2 sgRNA gene knockout kit (plasmid)
GTR15382601 1 Vial

Lentiviral human ADGRB2 sgRNA gene knockout kit - Lentiviral human ADGRB2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD5 Antibody
DL22024F-01 20 Tests

PE/Cyanine7 Anti-Mouse CD5 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD5 Antibody
DL22024F-02 50 Tests

PE/Cyanine7 Anti-Mouse CD5 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD5 Antibody
DL22024F-03 100 Tests

PE/Cyanine7 Anti-Mouse CD5 Antibody

Sign In for Pricing
View Details