Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chaetomium globosum Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

This Recombinant Chaetomium globosum Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Mitochondrial thiamine pyrophosphate carrier 1

UniProt

Q2HFL6

Expression Region

1-325

Origin

Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLKGDRLKDEGSRLQVTAAGATAGLVARFVIAPLDVVKIRLQLQTHSLSDPLSHRDLHG GPIYKGTLPTLRHILRSEGITGLWKGNVPAELLYVCYSAIQFTTYRTTTLLLHQTLGEGT LPPSAESFVAGAIGGGTATAATYPLDPAAHALRRPGQRSRVCESVARRGPDWVVRRAPVG FFGVWDRAWAQIIPYMSFFFATYETLRPHLSELELPFSSSSAVARTMASVMAKSRTFPLD LVRKRIQVQSPTRGRYVHKNIPEYYGGTVGALRTILQREGLRGLYRGLTVSLLKAAPASA VTMWTYERALKFYSGVGEKGEEQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte Marker (BM-1), CF405S conjugate, 0.1mg/mL
BNC040061-500 1x 500 µL

Granulocyte Marker (BM-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF488A conjugate, 0.1mg/mL
BNC881577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF568 conjugate, 0.1mg/mL
BNC680870-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF488A conjugate, 0.1mg/mL
BNC881791-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1791), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details