Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphatase-related protein type 1 (Lppr1)

This Recombinant Mouse Lipid phosphate phosphatase-related protein type 1 (Lppr1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 1, Plasticity-related gene 3 protein, PRG-3

UniProt

Q8BFZ2

Expression Region

1-325

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVENNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP GTEEESFISPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAEEKMILTGDCCYLSPL LRRIIRFIGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCQPNYTSTDCRAHQQFINNGN ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAF LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFRGTQGSPSKPKPEDPRGVPLM AFPRIESPLETLSAQNHSASMTEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSWIM2 Recombinant Protein (Rat)
RP238826 100 µg

ZSWIM2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
FAM189A1 AAV Vector (Human) (CMV)
19876101 1 µg

FAM189A1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Cas12a Nuclease
3373 80 µg - 1600 ng/µL

Cas12a Nuclease

Sign In for Pricing
View Details
Lep Rabbit Polyclonal Antibody
TA362909 100 µL

Lep Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DSTN Antibody
OACA02883-50UG 50 µg

DSTN Antibody

Sign In for Pricing
View Details
PLXNA2 Antibody
DF9760-01 100 µL

PLXNA2 Antibody

Sign In for Pricing
View Details