Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphatase-related protein type 1 (Lppr1)

This Recombinant Mouse Lipid phosphate phosphatase-related protein type 1 (Lppr1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 1, Plasticity-related gene 3 protein, PRG-3

UniProt

Q8BFZ2

Expression Region

1-325

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVENNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP GTEEESFISPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAEEKMILTGDCCYLSPL LRRIIRFIGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCQPNYTSTDCRAHQQFINNGN ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAF LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFRGTQGSPSKPKPEDPRGVPLM AFPRIESPLETLSAQNHSASMTEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CX-5461 dihydrochloride
orb1685890 500 mg

CX-5461 dihydrochloride

Sign In for Pricing
View Details
FAM149B1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-14730R-PerCP-Cy5.5 100 µL

FAM149B1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal PP2C alpha/PPM1A Antibody
NBP3-00058-50ul 50 µL

Rabbit Polyclonal PP2C alpha/PPM1A Antibody

Sign In for Pricing
View Details
Benzyl 2- (Acetylamino) -2-deoxy-3-O-[3,4,6-tri-O-acetyl-2- (acetylamino) -2-deoxy-β-D-glucopyranosyl]-α-D-galactopyranoside 4,6-Diacetate
sc-503450 1 mg

Benzyl 2- (Acetylamino) -2-deoxy-3-O-[3,4,6-tri-O-acetyl-2- (acetylamino) -2-deoxy-β-D-glucopyranosyl]-α-D-galactopyranoside 4,6-Diacetate

Sign In for Pricing
View Details
PmCherry-C1 actin-3XNLS P2A mCherry Plasmid
PVT81816 2 µg

PmCherry-C1 actin-3XNLS P2A mCherry Plasmid

Sign In for Pricing
View Details
Lentiviral human NUDT12 shRNA (UAS) - Lentiviral human NUDT12 shRNA (UAS, GFP) (100)
GTR15094977 1 Vial

Lentiviral human NUDT12 shRNA (UAS) - Lentiviral human NUDT12 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details